Ige Monoclonal Intibody Cost

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Ige Monoclonal Laboratories manufactures the ige monoclonal intibody cost reagents distributed by Genprice. The Ige Monoclonal Intibody Cost reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Ige products are available in stock. Specificity: Ige Category: Monoclonal Group: Intibody Cost

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Intibody Cost information

Mouse Anti Horse IgE Monoclonal Clone 3A1 Lyophilized

IMSAHSIGE3A1C500UG each
EUR 1147
Description: Mouse Anti Horse IgE Monoclonal Clone 3A1 Lyophilized

Mouse Anti Horse IgE Monoclonal Clone 3E6 Lyophilized

IMSAHSIGE3E6C500UG each
EUR 1147
Description: Mouse Anti Horse IgE Monoclonal Clone 3E6 Lyophilized

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), Biotinylated

4-MAA545Po21-Biotin
  • EUR 399.60
  • EUR 3331.20
  • EUR 967.20
  • EUR 494.40
  • EUR 273.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with Biotin.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), APC-Cy7

4-MAA545Po21-APC-Cy7
  • EUR 757.20
  • EUR 8752.80
  • EUR 2305.20
  • EUR 1015.20
  • EUR 412.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with APC-Cy7.

Mouse Monoclonal Anti-Cat IgE-HRP conjugate

71050-HP 0.5 ml
EUR 343.2

Mouse Anti Human IgE Monoclonal Clone 24A HRP Labeled

IMSAHUIGE24ACHRP1MG each
EUR 428
Description: Mouse Anti Human IgE Monoclonal Clone 24A HRP Labeled

Monoclonal Anti-Human IgE (clone 1), aff pure

IGEH11-M 100 ug
EUR 578.4

Monoclonal Anti-Human IgE (clone 2), aff pure

IGEH12-M 100 ug
EUR 578.4

Monoclonal Anti-Human IgE (clone 3), aff pure

IGEH13-M 100 ug
EUR 578.4

Mouse Monoclonal Anti-Cat IgE-Biotin conjugate

71050-BTN 0.5 ml
EUR 416.4

Mouse IgE Monoclonal Antibody, Isotype Control, Clone 2A101A12

7129 1 mg/ml x 0.5 ml
EUR 580.26
Description: Mouse IgE Monoclonal Antibody

Mouse Anti-Ovalbumin IgE Monoclonal Antibody, Clone E-C1

7091 1 mg/ml x 0.1 ml
EUR 406.26
Description: Mouse Anti-Ovalbumin IgE Monoclonal Antibody

Mouse Anti-Ovalbumin IgE Monoclonal Antibody, Clone E-G5

7092 1 mg/ml x 0.1 ml
EUR 406.26
Description: Mouse Anti-Ovalbumin IgE Monoclonal Antibody

Monoclonal Anti-Dog IgE, affinity purified, unlabeled

30389 100 ug
EUR 416.4

Mouse Monoclonal Anti-Cat IgE, aff pure, unlabeled

71050-UL 0.1 mg
EUR 270

Rat Anti Mouse Ige Heavy Chain Monoclonal Antibody

CABT-54633RM 0.25 mg
EUR 795.6

Mouse Monoclonal Anti-Dinitrophenyl (DNP) IgE, aff pure

DNP14-M 100 ug
EUR 578.4